{"product_id":"proteintech-19809-1-ap","title":"Proteintech, 19809-1-AP, RTCB-Specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RTCB-Specific (19809-1-AP) by Proteintech is a Polyclonal antibody targeting RTCB-Specific in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19809-1-AP targets RTCB-Specific in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: A431 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRTCB (also known as HSPC117, C22orf28, FAAP, and D10Wsu52e) is a essential subunit of the tRNA ligase complex, which is localized in both the cytoplasm and nucleus, and is involved in RNA repair and stress-induced splicing. As a multifunctional protein, RTCB also serves as a cell adhesion protein and plays an important role in embryo and placenta development. Recently, RTCB has been identified as an UPR RNA ligase that catalyzes unconventional XBP1 mRNA splicing. This antibody specifically recognizes endogenous RTCB protein. (25087875)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13836 Product name: Recombinant human C22orf28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-505 aa of BC000151 Sequence: GVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDFDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG Predict reactive species\nFull Name: chromosome 22 open reading frame 28\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC000151\nGene Symbol: RTCB\nGene ID (NCBI): 51493\nRRID: AB_10695047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3I0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960444585,"sku":"19809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19809-1-ap","provider":"Iright","version":"1.0","type":"link"}