{"product_id":"proteintech-19838-1-ap","title":"Proteintech, 19838-1-AP, TMX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMX2 (19838-1-AP) by Proteintech is a Polyclonal antibody targeting TMX2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19838-1-AP targets TMX2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, HeLa cells,  mouse placenta tissue,  mouse testis tissue,  rat tissue\nPositive IHC detected in: human kidney tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThioredoxin-related transmembrane proteins (TMXs) are protein disulfide isomerase (PDI) family members and possess a transmembrane region. TMX2 cDNA was first isolated in 2003, and TMX2 mRNA has been found in a variety of human tissues, with the highest levels in the heart, brain, liver, kidney, and pancreas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13828 Product name: Recombinant human TMX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-296 aa of BC000666 Sequence: PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK Predict reactive species\nFull Name: thioredoxin-related transmembrane protein 2\nCalculated Molecular Weight: 296 aa, 34 kDa\nObserved Molecular Weight: 30 kDa, 34 kDa\nGenBank Accession Number: BC000666\nGene Symbol: TMX2\nGene ID (NCBI): 51075\nRRID: AB_10642435\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y320\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834157225,"sku":"19838-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19838-1-ap","provider":"Iright","version":"1.0","type":"link"}