{"product_id":"proteintech-19849-1-ap","title":"Proteintech, 19849-1-AP, FAM50A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM50A (19849-1-AP) by Proteintech is a Polyclonal antibody targeting FAM50A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19849-1-AP targets FAM50A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: rat colon tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM50A belongs to the FAM50 family. It is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13907 Product name: Recombinant human FAM50A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-154 aa of BC000028 Sequence: KQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKR Predict reactive species\nFull Name: family with sequence similarity 50, member A\nCalculated Molecular Weight: 325 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC000028\nGene Symbol: FAM50A\nGene ID (NCBI): 9130\nRRID: AB_10641032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14320\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869681635497,"sku":"19849-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19849-1-ap","provider":"Iright","version":"1.0","type":"link"}