{"product_id":"proteintech-19851-1-ap","title":"Proteintech, 19851-1-AP, TMEM173\/STING Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM173\/STING (19851-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM173\/STING in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n19851-1-AP targets TMEM173\/STING in WB, IHC, IF\/ICC, IF-P, IF-Fro, FC (Intra), IP, CoIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HEK-293 cells,  HepG2 cells,  mouse kidney tissue,  mouse spleen tissue,  Raji cells,  THP-1 cells,  HT-29 cells,  mouse thymus tissue,  C2C12 cells,  RAW 264.7 cells,  mouse testis tissue\nPositive IP detected in: mouse spleen tissue\nPositive IHC detected in: human tonsillitis tissue, rat thymus tissue,  mouse thymus tissue,  human spleen tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\nPositive IF-Fro detected in: mouse brain tissue\nPositive IF\/ICC detected in: HT-29 cells, human tonsillitis tissue,  THP-1 cells\nPositive FC (Intra) detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey, bovine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species\nFull Name: transmembrane protein 173\nCalculated Molecular Weight: 379 aa, 42 kDa\nObserved Molecular Weight: 35-40 kDa, 80 kDa\nGenBank Accession Number: BC047779\nGene Symbol: STING\nGene ID (NCBI): 340061\nRRID: AB_10665370\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868819738793,"sku":"19851-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19851-1-ap","provider":"Iright","version":"1.0","type":"link"}