{"product_id":"proteintech-19857-1-ap","title":"Proteintech, 19857-1-AP, SMUG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMUG1 (19857-1-AP) by Proteintech is a Polyclonal antibody targeting SMUG1 in WB, ELISA applications with reactivity to human samples\n19857-1-AP targets SMUG1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293 cells,  HeLa cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930).Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5). This antibody is specific to UNG.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13934 Product name: Recombinant human SMUG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC000417 Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQS Predict reactive species\nFull Name: single-strand-selective monofunctional uracil-DNA glycosylase 1\nCalculated Molecular Weight: 177 aa, 20 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000417\nGene Symbol: SMUG1\nGene ID (NCBI): 23583\nRRID: AB_3085589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53HV7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810400425,"sku":"19857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19857-1-ap","provider":"Iright","version":"1.0","type":"link"}