{"product_id":"proteintech-19912-1-ap","title":"Proteintech, 19912-1-AP, PPDPF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPDPF (19912-1-AP) by Proteintech is a Polyclonal antibody targeting PPDPF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n19912-1-AP targets PPDPF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse pancreas tissue\nPositive IHC detected in: human colon cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13740 Product name: Recombinant human C20orf149 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC002531 Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS Predict reactive species\nFull Name: chromosome 20 open reading frame 149\nCalculated Molecular Weight: 114 aa, 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC002531\nGene Symbol: PPDPF\nGene ID (NCBI): 79144\nRRID: AB_10642438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3Y8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944158889,"sku":"19912-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-19912-1-ap","provider":"Iright","version":"1.0","type":"link"}