{"product_id":"proteintech-20114-1-ap","title":"Proteintech, 20114-1-AP, MGST3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MGST3 (20114-1-AP) by Proteintech is a Polyclonal antibody targeting MGST3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20114-1-AP targets MGST3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMicrosomal glutathione transferase 3 (MGST3) is member of microsomal prostaglandin E synthases super family that exhibits diversified functions in eicosanoid and GSH metabolism.  MGST3 expression level correlates with hippocampal size, and mutation of MGST3 contributes to spinal muscular dystrophy (PMID: 37760932). MGST3 KD did not alter intracellular reactive oxygen species level but selectively reduced the expression of apoptosis indicators which could be associated with the receptor of cysteinyl leukotrienes, the downstream metabolites of MGST3 in arachidonic acid pathway (PMID: 38971310).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13932 Product name: Recombinant human MGST3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC000505 Sequence: MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH Predict reactive species\nFull Name: microsomal glutathione S-transferase 3\nCalculated Molecular Weight: 152 aa, 17 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC000505\nGene Symbol: MGST3\nGene ID (NCBI): 4259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14880\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719174313,"sku":"20114-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20114-1-ap","provider":"Iright","version":"1.0","type":"link"}