{"product_id":"proteintech-20131-1-ap","title":"Proteintech, 20131-1-AP, SLC43A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC43A3 (20131-1-AP) by Proteintech is a Polyclonal antibody targeting SLC43A3 in WB, IHC, ELISA applications with reactivity to human samples\n20131-1-AP targets SLC43A3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, MCF-7 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSodium-independent purine-selective nucleobase transporter(SLC43A3), also called as equilibrative nucleobase transporter 1(ENBT1), is a nucleobase transporter involved in purine salvage pathways in mammals, which mediates the equilibrative transport of extracellular purine nucleobases such as adenine, guanine and hypoxanthine.(PubMed:26455426, PubMed:32339528) It has been found that it may regulate the transport of fatty acids (FA) in fat cells, as a positive regulator of FA efflux and as a negative regulator of FA uptake.(PMID: 32217606)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13999 Product name: Recombinant human SLC43A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 211-278 aa of BC003163 Sequence: GHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRR Predict reactive species\nFull Name: solute carrier family 43, member 3\nCalculated Molecular Weight: 491 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC003163\nGene Symbol: SLC43A3\nGene ID (NCBI): 29015\nRRID: AB_3085599\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NBI5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766308009,"sku":"20131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20131-1-ap","provider":"Iright","version":"1.0","type":"link"}