{"product_id":"proteintech-20136-1-ap","title":"Proteintech, 20136-1-AP, ZHX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZHX2 (20136-1-AP) by Proteintech is a Polyclonal antibody targeting ZHX2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20136-1-AP targets ZHX2 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  mouse brain tissue,  mouse skeletal muscle tissue,  mouse ovary tissue,  mouse lung tissue,  rat brain tissue,  Jurkat cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14088 Product name: Recombinant human ZHX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 488-837 aa of BC042145 Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA Predict reactive species\nFull Name: zinc fingers and homeoboxes 2\nCalculated Molecular Weight: 837 aa, 92 kDa\nObserved Molecular Weight: 92-100 kDa\nGenBank Accession Number: BC042145\nGene Symbol: ZHX2\nGene ID (NCBI): 22882\nRRID: AB_10666438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6X8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931412137,"sku":"20136-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20136-1-ap","provider":"Iright","version":"1.0","type":"link"}