{"product_id":"proteintech-20159-1-ap","title":"Proteintech, 20159-1-AP, GLB1L3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLB1L3 (20159-1-AP) by Proteintech is a Polyclonal antibody targeting GLB1L3 in WB, ELISA applications with reactivity to mouse, rat samples\n20159-1-AP targets GLB1L3 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlb1l3 is a member of the glycosyl hydrolase 35 family of proteins. These proteins display hydrolase activity catalyzing the cleavage of lactose, as well as galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans (PMID: 21633714). Glb1l3 has 3 isoforms produced by alternative splicing, which is 75kDa, 36kDa and 35kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14083 Product name: Recombinant human GLB1L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC011001 Sequence: MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIF Predict reactive species\nFull Name: galactosidase, beta 1-like 3\nCalculated Molecular Weight: 653 aa, 75 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC011001\nGene Symbol: GLB1L3\nGene ID (NCBI): 112937\nRRID: AB_3669325\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NCI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651705001,"sku":"20159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20159-1-ap","provider":"Iright","version":"1.0","type":"link"}