{"product_id":"proteintech-20174-1-ap","title":"Proteintech, 20174-1-AP, MARK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARK4 (20174-1-AP) by Proteintech is a Polyclonal antibody targeting MARK4 in IHC, ELISA applications with reactivity to human samples\n20174-1-AP targets MARK4 in IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue,  human colon tissue,  human gliomas tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARK4(MAP\/microtubule affinity-regulating kinase 4) is also named as KIAA1860, MARKL1 and belongs to the CAMK Ser\/Thr protein kinase family and SNF1 subfamily. It is directly involved in microtubule organization in neuronal cells and may contribute to the pathological phosphorylation of tau in Alzheimer's disease and it also plays a role in hepatocellular carcinogenesis. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 83 kDa and 75 kDa. MARK4 can exsit as 40-65 kDa forms in hippocampal homogenates from Alzheimer`s disease and non-demented elderly cases besides the full-length isoform 84 kDa. (PMID:24533944).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14013 Product name: Recombinant human MARK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 627-751 aa of BC009049 Sequence: VADEPERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDLE Predict reactive species\nFull Name: MAP\/microtubule affinity-regulating kinase 4\nCalculated Molecular Weight: 752 aa, 83 kDa\nGenBank Accession Number: BC009049\nGene Symbol: MARK4\nGene ID (NCBI): 57787\nRRID: AB_2636847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96L34\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882194601,"sku":"20174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20174-1-ap","provider":"Iright","version":"1.0","type":"link"}