{"product_id":"proteintech-20199-1-ap","title":"Proteintech, 20199-1-AP, STEAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STEAP1 (20199-1-AP) by Proteintech is a Polyclonal antibody targeting STEAP1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n20199-1-AP targets STEAP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells,  DU 145 cells\nPositive IP detected in: LNCaP cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14134 Product name: Recombinant human STEAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC011802 Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI Predict reactive species\nFull Name: six transmembrane epithelial antigen of the prostate 1\nCalculated Molecular Weight: 339 aa, 40 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC011802\nGene Symbol: STEAP1\nGene ID (NCBI): 26872\nRRID: AB_11182488\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHE8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609021609,"sku":"20199-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20199-1-ap","provider":"Iright","version":"1.0","type":"link"}