{"product_id":"proteintech-20331-1-ap","title":"Proteintech, 20331-1-AP, LTBR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LTBR (20331-1-AP) by Proteintech is a Polyclonal antibody targeting LTBR in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n20331-1-AP targets LTBR in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue\nPositive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14\/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14065 Product name: Recombinant human LTBR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-435 aa of BC026262 Sequence: KSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD Predict reactive species\nFull Name: lymphotoxin beta receptor (TNFR superfamily, member 3)\nCalculated Molecular Weight: 435 aa, 47 kDa\nObserved Molecular Weight: 47-60 kDa\nGenBank Accession Number: BC026262\nGene Symbol: LTBR\nGene ID (NCBI): 4055\nRRID: AB_10694276\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925612201,"sku":"20331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20331-1-ap","provider":"Iright","version":"1.0","type":"link"}