{"product_id":"proteintech-20341-1-ap","title":"Proteintech, 20341-1-AP, APJ\/APLNR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APJ\/APLNR (20341-1-AP) by Proteintech is a Polyclonal antibody targeting APJ\/APLNR in WB, ELISA applications with reactivity to human, mouse samples\n20341-1-AP targets APJ\/APLNR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPJ, also named APLNR and AGTRL1, belongs to the G-protein coupled receptor 1 family. It is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. APJ is an alternative coreceptor with CD4 for HIV-1 infection. It may be involved in the development of AIDS dementia. APJ is expressed abundantly in the corpus callosum and spinal cord.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14138 Product name: Recombinant human APLNR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC032688 Sequence: NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Predict reactive species\nFull Name: apelin receptor\nCalculated Molecular Weight: 380 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC032688\nGene Symbol: APJ\nGene ID (NCBI): 187\nRRID: AB_2878676\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35414\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868845789353,"sku":"20341-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20341-1-ap","provider":"Iright","version":"1.0","type":"link"}