{"product_id":"proteintech-20348-1-ap","title":"Proteintech, 20348-1-AP, SMEK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMEK2 (20348-1-AP) by Proteintech is a Polyclonal antibody targeting SMEK2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20348-1-AP targets SMEK2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  A2780 cells,  HeLa cells,  MCF-7 cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14156 Product name: Recombinant human SMEK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 589-738 aa of BC060855 Sequence: GLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVG Predict reactive species\nFull Name: SMEK homolog 2, suppressor of mek1 (Dictyostelium)\nCalculated Molecular Weight: 849 aa, 97 kDa\nObserved Molecular Weight: 94-97 kDa, 87 kDa\nGenBank Accession Number: BC060855\nGene Symbol: SMEK2\nGene ID (NCBI): 57223\nRRID: AB_10694150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5MIZ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869603319977,"sku":"20348-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20348-1-ap","provider":"Iright","version":"1.0","type":"link"}