{"product_id":"proteintech-20380-1-ap","title":"Proteintech, 20380-1-AP, AQP9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AQP9 (20380-1-AP) by Proteintech is a Polyclonal antibody targeting AQP9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n20380-1-AP targets AQP9 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, mouse brain tissue,  rat brain tissue,  mouse liver tissue,  mouse lung tissue,  mouse testis tissue,  rat liver tissue,  rat testis tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue, mouse brain tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAquaporins (AQPs), also known as water channel proteins, are members of a large protein family that osmotically modulate water fluid homeostasis in several tissues. AQP9 (Aquaporin 9) is a member of the aquaporin family that acts as a water-selective membrane channel, and it may be involved in cell migration, angiogenesis, and tumor growth. AQP9 is involved in arsenic uptake in hepatocellular carcinoma cells, in which p38-MAPK may play a limited role. AQP9 was demonstrated to promote astrocytoma cell invasion and motility via the AKT pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14200 Product name: Recombinant human AQP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-295 aa of BC026258 Sequence: SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKAEQSEDKPEKYELSVIM Predict reactive species\nFull Name: aquaporin 9\nCalculated Molecular Weight: 295 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC026258\nGene Symbol: AQP9\nGene ID (NCBI): 366\nRRID: AB_2935448\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43315\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869515337897,"sku":"20380-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20380-1-ap","provider":"Iright","version":"1.0","type":"link"}