{"product_id":"proteintech-20384-1-ap","title":"Proteintech, 20384-1-AP, NPHS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPHS2 (20384-1-AP) by Proteintech is a Polyclonal antibody targeting NPHS2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n20384-1-AP targets NPHS2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat kidney tissue\nPositive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat kidney tissue, mouse kidney tissue\nPositive IF-Fro detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPHS2 (also known as Podocin) is a membrane protein located on the podocyte foot process and is the critical component of the glomerular filtration barrier. Mutations of NPHS2 cause recessive steroidresistant nephrotic syndrome. Two isoforms of NPHS2 exist with molecular weights of 42 kDa and 35 kDa, respectively. (PMID: 21499232)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14213 Product name: Recombinant human NPHS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-315 aa of BC029141 Sequence: CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML Predict reactive species\nFull Name: nephrosis 2, idiopathic, steroid-resistant (podocin)\nCalculated Molecular Weight: 383 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC029141\nGene Symbol: NPHS2\nGene ID (NCBI): 7827\nRRID: AB_10697662\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP85\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836057257,"sku":"20384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20384-1-ap","provider":"Iright","version":"1.0","type":"link"}