{"product_id":"proteintech-20386-1-ap","title":"Proteintech, 20386-1-AP, CLN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLN3 (20386-1-AP) by Proteintech is a Polyclonal antibody targeting CLN3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20386-1-AP targets CLN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  SH-SY5Y cells,  Raji cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuronal ceroid lipofuscinosis (NCL, or Batten disease) refers to a group of lethal pediatric neurodegenerative diseases originating from mutations in one of the thus far identified 13 CLN genes (Ceroid Lipofuscinosis, Neuronal type; CLN1 to CLN14) (PMID: 25051496). CLN3 is a multi-membrane spanning protein that is involved in microtubule-dependent, anterograde transport of late endosomes and lysosomes. The CLN3 gene is located on chromosome 16p12.1and produces three mRNA splicing variants. The 438-amino-acid CLN3 protein has a calculated molecular weight of 48 kDa. It has been reported that CLN3 can be glycosylated and form homodimeric complex (PMID: 10356317; 17286803).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14224 Product name: Recombinant human CLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-368 aa of BC002394 Sequence: LVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFL Predict reactive species\nFull Name: ceroid-lipofuscinosis, neuronal 3\nCalculated Molecular Weight: 438 aa, 48 kDa\nObserved Molecular Weight: 45-48 kDa\nGenBank Accession Number: BC002394\nGene Symbol: CLN3\nGene ID (NCBI): 1201\nRRID: AB_10694819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13286\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886627115177,"sku":"20386-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20386-1-ap","provider":"Iright","version":"1.0","type":"link"}