{"product_id":"proteintech-20415-1-ap","title":"Proteintech, 20415-1-AP, MIF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIF (20415-1-AP) by Proteintech is a Polyclonal antibody targeting MIF in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n20415-1-AP targets MIF in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HL-60 cells,  U-937 cells,  Y79 cells,  U-87 MG cells,  HEK-293T cells,  HUVEC cells,  J774A.1 cells,  Neuro-2a cells,  mouse spleen tissue,  rat spleen tissue,  Jurkat cells\nPositive IP detected in: mouse spleen tissue\nPositive IF\/ICC detected in: U-251 cells\nPositive FC (Intra) detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species\nFull Name: macrophage migration inhibitory factor (glycosylation-inhibiting factor)\nCalculated Molecular Weight: 115 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC000447\nGene Symbol: MIF\nGene ID (NCBI): 4282\nRRID: AB_10694820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14174\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862959785,"sku":"20415-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20415-1-ap","provider":"Iright","version":"1.0","type":"link"}