{"product_id":"proteintech-20417-1-ap","title":"Proteintech, 20417-1-AP, PCNXL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCNXL2 (20417-1-AP) by Proteintech is a Polyclonal antibody targeting PCNXL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20417-1-AP targets PCNXL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCNXL2, also named as KIAA0435, belongs to the pecanex family. It may play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors. PCNXL2 is a glycosylation protein. The MW migrates to 260kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14161 Product name: Recombinant human PCNXL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1108-1201 aa of BC008300 Sequence: LSFAVSASTVFLSLRPFLSIVLFALAGAVGFVTHYVLPQLRKHHPWMWISHPILKNKEYHQREVRDVAHLMWFERLYVWLQCFEKYILYPALIL Predict reactive species\nFull Name: pecanex-like 2 (Drosophila)\nCalculated Molecular Weight: 2137 aa, 237 kDa\nObserved Molecular Weight: 237-260 kDa\nGenBank Accession Number: BC008300\nGene Symbol: PCNXL2\nGene ID (NCBI): 80003\nRRID: AB_10792807\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NKB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887753679017,"sku":"20417-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20417-1-ap","provider":"Iright","version":"1.0","type":"link"}