{"product_id":"proteintech-20436-1-ap","title":"Proteintech, 20436-1-AP, GLUT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLUT2 (20436-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20436-1-AP targets GLUT2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse kidney tissue,  HEK 293 cells,  HepG2 cells,  NIH\/3T3 cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucose transporter 2 (GLUT2), also known as solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2), is a transporter protein regulating glucose transport across cell membranes in an insulin-independent manner.What is the molecular weight of GLUT2? Is GLUT2 post-translationally modified?GLUT2 can be N-glycosylated. The molecular weight of mature glycosylated GLUT2 transporter is between 55 and 65 kDa, but a minor 38-kDa form is often detected in hepatocytes that may represent a non-glycosylated or proteolytic product (PMID: 12101013).What is the subcellular localization of GLUT2?Glucose transporters, including GLUT2, are multiple-pass integral membrane proteins. GLUT2 is present at the plasma membrane but has also been reported to be present at intracellular membranes, including the endoplasmic reticulum (PMID: 12101013).What molecules can be transported by GLUT2?Although the main substrate of GLUT2 transport is glucose, it can also transport galactose, mannose, and fructose.What is the tissue expression pattern of GLUT2?GLUT2 is expressed in many cell types. High expression of GLUT2 is observed in hepatocytes, where GLUT2 mediates glucose uptake and release regulating glucose levels in blood, in intestinal cells, where it regulates glucose transport at the basolateral membrane and to a lesser extent from the apical membrane, and in the kidney proximal tubule, where it is involved in glucose reabsorption and is present at the basolateral membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, sheep, lasiopodomys brandtii\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14204 Product name: Recombinant human SLC2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 2\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 60-70 kDa, 38-45 kDa\nGenBank Accession Number: BC060041\nGene Symbol: GLUT2\nGene ID (NCBI): 6514\nRRID: AB_2750600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11168\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868831207593,"sku":"20436-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20436-1-ap","provider":"Iright","version":"1.0","type":"link"}