{"product_id":"proteintech-20456-1-ap","title":"Proteintech, 20456-1-AP, EI24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EI24 (20456-1-AP) by Proteintech is a Polyclonal antibody targeting EI24 in WB, IHC, ELISA applications with reactivity to human samples\n20456-1-AP targets EI24 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HT-1080 cells,  HeLa cells,  L02 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEi24 is an ER-localized protein originally identified as a p53-induced proapoptotic gene in etoposide-treated NIH3T3 cells. It has been shown to be able to bind to the antiapoptotic protein Bcl-2 (PMID: 15781622), play a role in autophagy (PMID: 23074225), and induce proliferate arrest\/apoptosis (PMID: 10594026). Ei24 can bind specifically to IMPβ1 and IMPα2 to impede their normal role in nuclear import (PMID: 24821838).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14169 Product name: Recombinant human EI24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 267-340 aa of BC002390 Sequence: SILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH Predict reactive species\nFull Name: etoposide induced 2.4 mRNA\nCalculated Molecular Weight: 340 aa, 39 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC002390\nGene Symbol: EI24\nGene ID (NCBI): 9538\nRRID: AB_10858326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14681\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869458354345,"sku":"20456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20456-1-ap","provider":"Iright","version":"1.0","type":"link"}