{"product_id":"proteintech-20463-1-ap","title":"Proteintech, 20463-1-AP, TSPAN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN2 (20463-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN2 in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n20463-1-AP targets TSPAN2 in WB, IF, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, K-562 cells\nPositive IP detected in: HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN2 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. It has been reported that TSPAN2 is involved in cell invasion and motility during lung cancer progression (PMID: 24726368). TSPAN2 enhances cell motility and invasiveness by assisting CD44 in scavenging intracellular reactive oxygen species.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14299 Product name: Recombinant human TSPAN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-199 aa of BC021675 Sequence: AEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGL Predict reactive species\nFull Name: tetraspanin 2\nCalculated Molecular Weight: 221 aa, 24 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC021675\nGene Symbol: TSPAN2\nGene ID (NCBI): 10100\nRRID: AB_2878691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60636\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869505966249,"sku":"20463-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20463-1-ap","provider":"Iright","version":"1.0","type":"link"}