{"product_id":"proteintech-20469-1-ap","title":"Proteintech, 20469-1-AP, SLC37A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC37A2 (20469-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20469-1-AP targets SLC37A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, HeLa cells,  RAW 264.7 cells,  mouse spleen tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe solute carrier family 37 (SLC37) consists of four sugar-phosphate exchangers, A1, A2, A3, and A4, which are anchored in the endoplasmic reticulum (ER) membrane (PMID:23506893). Solute Carrier Family 37 Member 2 (SLC37A2), also knows as SPX2, was firstly identified in a work, conducted on mice and aimed to detect cAMP inducible genes playing a role in promoting cholesterol efflux from the macrophage cell line RAW264 via apoE and apoA1 (PMID:11004510). Interestingly, of the four SLC37A members, SLC37A2 displays the highest level of transcript abundance in neutrophils and macrophages ,indicating that SLC37A2 may play an essential role in regulating innate immune function (PMID:32428862).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14306 Product name: Recombinant human SLC37A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-313 aa of BC051314 Sequence: VMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYT Predict reactive species\nFull Name: solute carrier family 37 (glycerol-3-phosphate transporter), member 2\nCalculated Molecular Weight: 505 aa, 55 kDa\nObserved Molecular Weight: 50-75 kDa\nGenBank Accession Number: BC051314\nGene Symbol: SLC37A2\nGene ID (NCBI): 219855\nRRID: AB_10733754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TED4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602599081,"sku":"20469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20469-1-ap","provider":"Iright","version":"1.0","type":"link"}