{"product_id":"proteintech-20495-1-ap","title":"Proteintech, 20495-1-AP, ATRX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATRX (20495-1-AP) by Proteintech is a Polyclonal antibody targeting ATRX in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20495-1-AP targets ATRX in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2\/SNF2) family of helicases\/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma  and osteosarcoma(PMID: 32015155).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13984 Product name: Recombinant human ATRX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-87 aa of BC002521 Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN Predict reactive species\nFull Name: alpha thalassemia\/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae)\nCalculated Molecular Weight: 2492 aa, 283 kDa\nObserved Molecular Weight: 280-300 kDa\nGenBank Accession Number: BC002521\nGene Symbol: ATRX\nGene ID (NCBI): 546\nRRID: AB_3085606\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46100\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885143150761,"sku":"20495-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20495-1-ap","provider":"Iright","version":"1.0","type":"link"}