{"product_id":"proteintech-20496-1-ap","title":"Proteintech, 20496-1-AP, CEPT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEPT1 (20496-1-AP) by Proteintech is a Polyclonal antibody targeting CEPT1 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20496-1-AP targets CEPT1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissue, human cervical cancer tissue,  human pancreas tissue,  human tonsillitis tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCholine-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species\nFull Name: choline\/ethanolamine phosphotransferase 1\nCalculated Molecular Weight: 416 aa, 47 kDa\nGenBank Accession Number: BC032610\nGene Symbol: CEPT1\nGene ID (NCBI): 10390\nRRID: AB_10694283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6K0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978270377,"sku":"20496-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20496-1-ap","provider":"Iright","version":"1.0","type":"link"}