{"product_id":"proteintech-20502-1-ap","title":"Proteintech, 20502-1-AP, STARD3NL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STARD3NL (20502-1-AP) by Proteintech is a Polyclonal antibody targeting STARD3NL in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20502-1-AP targets STARD3NL in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HEK-293 cells,  mouse kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14273 Product name: Recombinant human STARD3NL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-234 aa of BC005959 Sequence: ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL Predict reactive species\nFull Name: STARD3 N-terminal like\nCalculated Molecular Weight: 234 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC005959\nGene Symbol: STARD3NL\nGene ID (NCBI): 83930\nRRID: AB_10694281\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869772894377,"sku":"20502-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20502-1-ap","provider":"Iright","version":"1.0","type":"link"}