{"product_id":"proteintech-20542-1-ap","title":"Proteintech, 20542-1-AP, NUDT3\/4\/10\/11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT3\/4\/10\/11 (20542-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT3\/4\/10\/11 in WB, ELISA applications with reactivity to human,  mouse, rat samples\n20542-1-AP targets NUDT3\/4\/10\/11 in WB, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT3 (nucleoside diphosphate linked moiety X-type motif 3), also named as DIPP1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α\/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3\/4\/10\/11).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14587 Product name: Recombinant human NUDT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC007727 Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 3\nCalculated Molecular Weight: 172 aa, 19 kDa\nObserved Molecular Weight: 20-30 kDa\nGenBank Accession Number: BC007727\nGene Symbol: NUDT3\nGene ID (NCBI): 11165\nRRID: AB_10696178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95989\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869721448617,"sku":"20542-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20542-1-ap","provider":"Iright","version":"1.0","type":"link"}