{"product_id":"proteintech-20587-1-ap","title":"Proteintech, 20587-1-AP, SSTR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SSTR1 (20587-1-AP) by Proteintech is a Polyclonal antibody targeting SSTR1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n20587-1-AP targets SSTR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  BxPC-3 cells,  mouse brain tissue,  mouse small intestine tissue,  SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14287 Product name: Recombinant human SSTR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC035618 Sequence: MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL Predict reactive species\nFull Name: somatostatin receptor 1\nCalculated Molecular Weight: 391 aa, 43 kDa\nObserved Molecular Weight: 53 kDa, 63 kDa\nGenBank Accession Number: BC035618\nGene Symbol: SSTR1\nGene ID (NCBI): 6751\nRRID: AB_10755146\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30872\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869771944105,"sku":"20587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20587-1-ap","provider":"Iright","version":"1.0","type":"link"}