{"product_id":"proteintech-20612-1-ap","title":"Proteintech, 20612-1-AP, SLC37A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC37A4 (20612-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20612-1-AP targets SLC37A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  mouse kidney tissue,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14660 Product name: Recombinant human SLC37A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC015650 Sequence: MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIF Predict reactive species\nFull Name: solute carrier family 37 (glucose-6-phosphate transporter), member 4\nCalculated Molecular Weight: 429 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC015650\nGene Symbol: SLC37A4\nGene ID (NCBI): 2542\nRRID: AB_10858386\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43826\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869500035241,"sku":"20612-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20612-1-ap","provider":"Iright","version":"1.0","type":"link"}