{"product_id":"proteintech-20641-1-ap","title":"Proteintech, 20641-1-AP, PTPIP51 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPIP51 (20641-1-AP) by Proteintech is a Polyclonal antibody targeting PTPIP51 in WB, IHC, IP, ELISA applications with reactivity to human samples\n20641-1-AP targets PTPIP51 in WB, IHC, IF, IP, COIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human paracancerous of skin cancer, human cervical cancer tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618). The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14708 Product name: Recombinant human PTPIP51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC008970 Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH Predict reactive species\nFull Name: family with sequence similarity 82, member A2\nCalculated Molecular Weight: 470 aa, 52 kDa\nObserved Molecular Weight: 52-60 kDa\nGenBank Accession Number: BC008970\nGene Symbol: PTPIP51\nGene ID (NCBI): 55177\nRRID: AB_10695187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96TC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869972137,"sku":"20641-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20641-1-ap","provider":"Iright","version":"1.0","type":"link"}