{"product_id":"proteintech-20765-1-ap","title":"Proteintech, 20765-1-AP, NT5M Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NT5M (20765-1-AP) by Proteintech is a Polyclonal antibody targeting NT5M in WB, IP, ELISA applications with reactivity to mouse samples\n20765-1-AP targets NT5M in WB, IP, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNT5M is a mitochondrial 5′(3′)-deoxyribonucleotidase that plays a crucial role in maintaining balanced deoxynucleotide pools essential for mitochondrial DNA synthesis. It dephosphorylates specific nucleoside monophosphates, particularly dUMP and dTMP, thereby preventing the accumulation of toxic dTTP. NT5M is predominantly localized in mitochondria and is highly expressed in tissues such as the heart, brain, and skeletal muscle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14743 Product name: Recombinant human NT5M protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-228 aa of BC035838 Sequence: LRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC Predict reactive species\nFull Name: 5',3'-nucleotidase, mitochondrial\nCalculated Molecular Weight: 228 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC035838\nGene Symbol: NT5M\nGene ID (NCBI): 56953\nRRID: AB_10733338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPB1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869721186473,"sku":"20765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20765-1-ap","provider":"Iright","version":"1.0","type":"link"}