{"product_id":"proteintech-20776-1-ap","title":"Proteintech, 20776-1-AP, FAM96A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM96A (20776-1-AP) by Proteintech is a Polyclonal antibody targeting FAM96A in IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n20776-1-AP targets FAM96A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: U-937 cells, THP-1 cells\nPositive IHC detected in: mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM96A (family with sequence similarity 96, member A), also called cytosolic iron-sulfur assembly component 2A (CIAO2A), a recently identified member of the cytosolic iron-sulfur (Fe\/S) protein assembly machinery and regulator of cellular iron homeostasis, is a novel pro-apoptotic APAF1-binding protein facilitating the effective induction of cell death via the mitochondrial apoptosis pathway. FAM96A is substantially enriched in macrophages comprised primarily of a DUF59 domain (residues 31-157) and an N-terminal signal peptide (residues 1-27), that is expressed at low levels in tumor cells (PMID: 29399066).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14770 Product name: Recombinant human FAM96A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC008865 Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHC Predict reactive species\nFull Name: family with sequence similarity 96, member A\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC008865\nGene Symbol: FAM96A\nGene ID (NCBI): 84191\nRRID: AB_3669346\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5X1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869681897641,"sku":"20776-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20776-1-ap","provider":"Iright","version":"1.0","type":"link"}