{"product_id":"proteintech-20787-1-ap","title":"Proteintech, 20787-1-AP, SMO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMO (20787-1-AP) by Proteintech is a Polyclonal antibody targeting SMO in IHC, ELISA applications with reactivity to human, mouse, rat samples\n20787-1-AP targets SMO in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human prostate cancer tissue, human testis tissue,  human colon cancer tissue,  mouse testis tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmoothened (SMO) is a G protein-coupled receptor that is a component of the hedgehog (Hh) signaling pathway and is conserved from flies to humans. The Hh pathway plays a central role in animal development and stem-cell function. Defects in Hh signaling lead to birth defects and cancer in humans. Expressed on the primary cilium, SMO interacts with the patched protein, a receptor for Hh proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14322 Product name: Recombinant human SMO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-787 aa of BC009989 Sequence: RRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF Predict reactive species\nFull Name: smoothened homolog (Drosophila)\nCalculated Molecular Weight: 787 aa, 86 kDa\nGenBank Accession Number: BC009989\nGene Symbol: SMO\nGene ID (NCBI): 6608\nRRID: AB_2878740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99835\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848672937,"sku":"20787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20787-1-ap","provider":"Iright","version":"1.0","type":"link"}