{"product_id":"proteintech-20792-1-ap","title":"Proteintech, 20792-1-AP, RNF133 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF133 (20792-1-AP) by Proteintech is a Polyclonal antibody targeting RNF133 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20792-1-AP targets RNF133 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells\nPositive IHC detected in: mouse testis tissue, human brain tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF133 (ring finger protein 133) contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14537 Product name: Recombinant human RNF133 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-376 aa of BC022038 Sequence: YHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP Predict reactive species\nFull Name: ring finger protein 133\nCalculated Molecular Weight: 376 aa, 42 kDa\nObserved Molecular Weight: 45-48 kDa\nGenBank Accession Number: BC022038\nGene Symbol: RNF133\nGene ID (NCBI): 168433\nRRID: AB_10695189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVZ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887785988265,"sku":"20792-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20792-1-ap","provider":"Iright","version":"1.0","type":"link"}