{"product_id":"proteintech-20793-1-ap","title":"Proteintech, 20793-1-AP, EVA1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EVA1B (20793-1-AP) by Proteintech is a Polyclonal antibody targeting EVA1B in WB, ELISA applications with reactivity to human samples\n20793-1-AP targets EVA1B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEVA1B, also known as FAM176B or C1orf78, is a single-pass membrane protein that belongs to the FAM176 family. EVA1B is an important paralog of the EVA1A and is associated with the tumor immune microenvironment and clinical prognosis\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14578 Product name: Recombinant human FAM176B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006241 Sequence: MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVF Predict reactive species\nFull Name: family with sequence similarity 176, member B\nCalculated Molecular Weight: 165 aa, 18 kDa\nObserved Molecular Weight: 25-26 kDa\nGenBank Accession Number: BC006241\nGene Symbol: FAM176B\nGene ID (NCBI): 55194\nRRID: AB_3669348\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628538025,"sku":"20793-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20793-1-ap","provider":"Iright","version":"1.0","type":"link"}