{"product_id":"proteintech-20807-1-ap","title":"Proteintech, 20807-1-AP, Neuron navigator 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neuron navigator 1 (20807-1-AP) by Proteintech is a Polyclonal antibody targeting Neuron navigator 1 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n20807-1-AP targets Neuron navigator 1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human heart tissue,  human placenta tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuron navigator 1 (NAV1) gene encodes a large protein belongs to the Nav\/unc-53 family and 7 isoforms of NAV1 are produced by alternative splicing. NAV1 is localized in cytoplasm and expressed at high levels in heart, skeletal muscle and placenta, and especially in neuronal growth cones. Besides its nucleotide binding activity, NAV1 interacts with tubulin and associates with a subset of microtubule plus end, therefore playing a role in neuronal migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14747 Product name: Recombinant human NAV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1359-1530 aa of BC007523 Sequence: LKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSL Predict reactive species\nFull Name: neuron navigator 1\nCalculated Molecular Weight: 1877 aa, 202 kDa\nGenBank Accession Number: BC007523\nGene Symbol: NAV1\nGene ID (NCBI): 89796\nRRID: AB_10732685\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887735296169,"sku":"20807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20807-1-ap","provider":"Iright","version":"1.0","type":"link"}