{"product_id":"proteintech-20822-1-ap","title":"Proteintech, 20822-1-AP, GALNT10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GALNT10 (20822-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT10 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n20822-1-AP targets GALNT10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, HepG2 cells,  mouse ovary tissue\nPositive IHC detected in: human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGALNT10 is a member of the N-acetylgalactosyltransferase family and an enzyme that catalyzes the first step in O-glycan synthesis. O-glycosylation is closely related to cell recognition, tumor cell growth, metastasis and adhesion. GALNT10 can change the cell connection and communication environment between cells, thus achieving specific biological effects. GALNT10 is highly expressed in many tumors and the tumor migration and invasion ability can be suppressed by inhibiting the expression of GALNT10 (PMID: 33275228). GALNT10 is a prognostic biomarker of high-grade ovarian serous cancer (HGSC) patients (PMID: 31853576). GALNT10 has 4 isoforms with the molecular mass of 32, 41, 62 and 69 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14751 Product name: Recombinant human GALNT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-603 aa of BC007224 Sequence: EYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN Predict reactive species\nFull Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)\nCalculated Molecular Weight: 603 aa, 69 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC007224\nGene Symbol: GALNT10\nGene ID (NCBI): 55568\nRRID: AB_3085622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86SR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887646658729,"sku":"20822-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20822-1-ap","provider":"Iright","version":"1.0","type":"link"}