{"product_id":"proteintech-20863-1-ap","title":"Proteintech, 20863-1-AP, FAM76A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM76A (20863-1-AP) by Proteintech is a Polyclonal antibody targeting FAM76A in WB, IHC, ELISA applications with reactivity to human, mouse samples\n20863-1-AP targets FAM76A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM76A is a member of FAM76 family. It is reported that FAM76A may be regulated by WTAP. FAM76A is highly expressed in the WTAP high-expression group and also expressed at low levels in the WTAP low-expression group, which can be confirmed by TCGA data (PMID: 32998774).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14904 Product name: Recombinant human FAM76A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-227 aa of BC025768 Sequence: QRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVAT Predict reactive species\nFull Name: family with sequence similarity 76, member A\nCalculated Molecular Weight: 307 aa, 35 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC025768\nGene Symbol: FAM76A\nGene ID (NCBI): 199870\nRRID: AB_10693681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633748137,"sku":"20863-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20863-1-ap","provider":"Iright","version":"1.0","type":"link"}