{"product_id":"proteintech-20873-1-ap","title":"Proteintech, 20873-1-AP, VMAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VMAT2 (20873-1-AP) by Proteintech is a Polyclonal antibody targeting VMAT2 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n20873-1-AP targets VMAT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells, Jurkat cells\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: rat cerebellum tissue, mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVMAT2 is a vesicular monoamine transporter that is responsible for the uptake and storage of monoamines (dopaine, norepinephrine, epinephrine, histamine and serotonin) in neurons, endocrine cells, and tumors deriving from these cells. Histamine-producing endocrine tumors (gastric carcinoids) expressed VMAT2 almost exclusively, thus VMAT2 is useful in classification of neuroendocrine tumors. Reduced expression of VMAT2 has often been observed in Parkinson's diseased (PD) brain, and detection of VMAT2 can be used to reflect the 4-(2-aminoethyl)benzene-1,2-diol neuron loss and predict the disease process. Several forms of VMAT2 can be observed upon the glycosylation: 45 kDa band corresponds to the native (deglycosylated) form, and the 55 and 75 kDa bands to glycosylated forms (PMID: 17582657).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14971 Product name: Recombinant human VMAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-127 aa of BC108928 Sequence: VVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNE Predict reactive species\nFull Name: solute carrier family 18 (vesicular monoamine), member 2\nCalculated Molecular Weight: 514 aa, 56 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC108928\nGene Symbol: VMAT2\nGene ID (NCBI): 6571\nRRID: AB_10858619\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05940\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938162345,"sku":"20873-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20873-1-ap","provider":"Iright","version":"1.0","type":"link"}