{"product_id":"proteintech-20876-1-ap","title":"Proteintech, 20876-1-AP, MIEN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIEN1 (20876-1-AP) by Proteintech is a Polyclonal antibody targeting MIEN1 in WB, ELISA applications with reactivity to human samples\n20876-1-AP targets MIEN1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, DU 145 cells,  SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC17orf37 (chromosome 17 open reading frame 37), also known as C35\/Rdx12\/MGC14832, is located on human chromosome 17q12, 505 nucleotides from the 3¶ end of the ERBB2 oncogenes. C17orf37 expression positively correlates with grade and stage of breast cancer, and increased expression has been shown in prostate cancer cells and tissue specimens (PMID: 17121940, 19503095)..C17orf37 gene encodes a 12-kDa protein that does not have sequence similarity with any known protein. C17orf37 is expressed as a cytosolic protein with predominant membrane localization (PMID: 21628459).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14975 Product name: Recombinant human C17orf37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC006006 Sequence: MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL Predict reactive species\nFull Name: chromosome 17 open reading frame 37\nCalculated Molecular Weight: 115 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC006006\nGene Symbol: C17orf37\nGene ID (NCBI): 84299\nRRID: AB_3085626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRT3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719436457,"sku":"20876-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20876-1-ap","provider":"Iright","version":"1.0","type":"link"}