{"product_id":"proteintech-20878-1-ap","title":"Proteintech, 20878-1-AP, LZTS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LZTS1 (20878-1-AP) by Proteintech is a Polyclonal antibody targeting LZTS1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20878-1-AP targets LZTS1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  human testis tissue,  mouse ovary tissue,  mouse thymus tissue,  PC-3 cells,  rat brain tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14977 Product name: Recombinant human LZTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 397-596 aa of BC075007 Sequence: QLKESQTEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI Predict reactive species\nFull Name: leucine zipper, putative tumor suppressor 1\nCalculated Molecular Weight: 596 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC075007\nGene Symbol: LZTS1\nGene ID (NCBI): 11178\nRRID: AB_10693683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y250\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869470675113,"sku":"20878-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20878-1-ap","provider":"Iright","version":"1.0","type":"link"}