{"product_id":"proteintech-20887-1-ap","title":"Proteintech, 20887-1-AP, Caldesmon Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caldesmon (20887-1-AP) by Proteintech is a Polyclonal antibody targeting Caldesmon in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n20887-1-AP targets Caldesmon in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HeLa cells,  HT-1080 cells,  MDA-MB-231 cells,  PC-3 cells,  SKOV-3 cells\nPositive IHC detected in: human colon tissue, mouse heart tissue,  human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1\/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species\nFull Name: caldesmon 1\nCalculated Molecular Weight: 538 aa, 63 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC040354\nGene Symbol: CALD1\nGene ID (NCBI): 800\nRRID: AB_10792408\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05682\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939243689,"sku":"20887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20887-1-ap","provider":"Iright","version":"1.0","type":"link"}