{"product_id":"proteintech-20953-1-ap","title":"Proteintech, 20953-1-AP, KCNJ1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNJ1 (20953-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n20953-1-AP targets KCNJ1 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCNJ1, also called ROMK, is an inward-rectifying K+ channel responsible for basal (non-flow stimulated) K+ secretion. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium. This channel is activated by internal ATP and can be blocked by external barium. The calculated molecule weight is 45kDa, 20953-1-AP can detect the band around 75-80 kDa, it has been considered to be a dimer of KCNJ1.(PMID: 17804670; 7929082; 15767585)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15100 Product name: Recombinant human KCNJ1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 178-391 aa of BC074752 Sequence: ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM Predict reactive species\nFull Name: potassium inwardly-rectifying channel, subfamily J, member 1\nCalculated Molecular Weight: 391 aa, 45 kDa\nObserved Molecular Weight: 75-80 kDa\nGenBank Accession Number: BC074752\nGene Symbol: KCNJ1\nGene ID (NCBI): 3758\nRRID: AB_10732600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48048\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869553021097,"sku":"20953-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-20953-1-ap","provider":"Iright","version":"1.0","type":"link"}