{"product_id":"proteintech-21024-1-ap","title":"Proteintech, 21024-1-AP, RNF170 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF170 (21024-1-AP) by Proteintech is a Polyclonal antibody targeting RNF170 in WB, IHC, ELISA applications with reactivity to human samples\n21024-1-AP targets RNF170 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human breast cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF170 is an E3 ubiquitin ligase that resides in the endoplasmic reticulum (ER) membrane and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors by the ER-associated protein degradation (ERAD) pathway. It has 6 isoforms produced by Alternative splicing with the molecular weight of 30 kDa, 27 kDa, 22 kDa, 20 kDa, 19 kDa, and 13 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15288 Product name: Recombinant human RNF170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC032393 Sequence: MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT Predict reactive species\nFull Name: ring finger protein 170\nCalculated Molecular Weight: 258 aa, 30 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC032393\nGene Symbol: RNF170\nGene ID (NCBI): 81790\nRRID: AB_10733119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96K19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887786381481,"sku":"21024-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21024-1-ap","provider":"Iright","version":"1.0","type":"link"}