{"product_id":"proteintech-21038-1-ap","title":"Proteintech, 21038-1-AP, FAM78A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM78A (21038-1-AP) by Proteintech is a Polyclonal antibody targeting FAM78A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21038-1-AP targets FAM78A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  HepG2 cells,  human liver tissue,  mouse spleen tissue\nPositive IHC detected in: human tonsillitis tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15366 Product name: Recombinant human FAM78A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-57 aa of BC049388 Sequence: QSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTPHFRASAQVVM Predict reactive species\nFull Name: family with sequence similarity 78, member A\nCalculated Molecular Weight: 283 aa, 32 kDa\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: BC049388\nGene Symbol: FAM78A\nGene ID (NCBI): 286336\nRRID: AB_10973677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5JUQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633879209,"sku":"21038-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21038-1-ap","provider":"Iright","version":"1.0","type":"link"}