{"product_id":"proteintech-21039-1-ap","title":"Proteintech, 21039-1-AP, FRMD6\/Willin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FRMD6\/Willin (21039-1-AP) by Proteintech is a Polyclonal antibody targeting FRMD6\/Willin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n21039-1-AP targets FRMD6\/Willin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells\nPositive IHC detected in: human liver cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWillin, also known as FRMD6 or human Expanded (hEx), is a member of the FERM-domain family of cytoskeletal crosslinkers. It is a potent inhibitor of cell proliferation, transformation and modulator of drug sensitivity, suggesting it possesses tumor suppressor properties. Willin is widely expressed in normal tissues. Although willin is found in the cytoplasm and membrane, it localizes to the nuclei of almost all tumors.This antibody was raised against the C-terminal region of human FRMD6 protein and is expected to recognize the endogenous FRMD6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15375 Product name: Recombinant human Willin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC029870 Sequence: LDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV Predict reactive species\nFull Name: FERM domain containing 6\nCalculated Molecular Weight: 622 aa, 72 kDa\nObserved Molecular Weight: 72, 70, 30 kDa\nGenBank Accession Number: BC029870\nGene Symbol: FRMD6\/Willin\nGene ID (NCBI): 122786\nRRID: AB_2878797\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NE9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869685174441,"sku":"21039-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21039-1-ap","provider":"Iright","version":"1.0","type":"link"}