{"product_id":"proteintech-21042-1-ap","title":"Proteintech, 21042-1-AP, CAR\/NR1I3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAR\/NR1I3 (21042-1-AP) by Proteintech is a Polyclonal antibody targeting CAR\/NR1I3 in WB, ELISA applications with reactivity to human samples\n21042-1-AP targets CAR\/NR1I3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe nuclear hormone receptor superfamily is a large group of related transcription factors which includes members that bind a diverse array of ligands, including steroids, retinoic acid, thyroid hormone, and vitamin D. Nuclear hormone receptors contain a DNA-binding domain (DBD) and a ligand-binding domain [PMID: 10221899]. Nuclear receptor subfamily 1 group I member 3 (NR1I3; Constitutive androstane receptor: CAR), binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. It is expressed primarily in liver and regulates the expression of genes involved in xenobiotic metabolism as well as hormone, energy, and lipid homeostasis [PMID:22896671].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15378 Product name: Recombinant human NR1I3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-156 aa of BC069651 Sequence: RRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSL Predict reactive species\nFull Name: nuclear receptor subfamily 1, group I, member 3\nCalculated Molecular Weight: 352 aa, 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC069651\nGene Symbol: NR1I3\nGene ID (NCBI): 9970\nRRID: AB_10732602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14994\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963393705,"sku":"21042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21042-1-ap","provider":"Iright","version":"1.0","type":"link"}