{"product_id":"proteintech-21074-1-ap","title":"Proteintech, 21074-1-AP, TRIM54 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM54 (21074-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM54 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21074-1-AP targets TRIM54 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, human skeletal muscle tissue,  human heart tissue\nPositive IHC detected in: human heart tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM54 (Tripartite motif-containing protein 54) is also names as MURF, MURF3, RNF30. The expression of TRIM54 is required for skeletal myoblast differentiation and myotube fusion. It is expressed in heart and skeletal muscle specifically (PMID:11243782). It has two isoforms with the molecular weight of 40KDa and 45KDa. It can be dimerizated and hetero-dimerizated to form homooligomer and heterooligomer (PMID:15967462).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15229 Product name: Recombinant human TRIM54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-358 aa of BC141807 Sequence: IAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP Predict reactive species\nFull Name: tripartite motif-containing 54\nCalculated Molecular Weight: 358 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC141807\nGene Symbol: TRIM54\nGene ID (NCBI): 57159\nRRID: AB_10694832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388656809,"sku":"21074-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21074-1-ap","provider":"Iright","version":"1.0","type":"link"}