{"product_id":"proteintech-21079-1-ap","title":"Proteintech, 21079-1-AP, FAM119A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM119A (21079-1-AP) by Proteintech is a Polyclonal antibody targeting FAM119A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21079-1-AP targets FAM119A in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, L02 cells,  THP-1 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15282 Product name: Recombinant human FAM119A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-218 aa of BC033720 Sequence: ITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL Predict reactive species\nFull Name: family with sequence similarity 119, member A\nCalculated Molecular Weight: 218 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC033720\nGene Symbol: FAM119A\nGene ID (NCBI): 151194\nRRID: AB_10755289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXB1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460353193,"sku":"21079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21079-1-ap","provider":"Iright","version":"1.0","type":"link"}